Structure of PDB 7lki Chain DDD Binding Site BS01

Receptor Information
>7lki Chain DDD (length=206) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKLEESGGGLVQPGGSMKLSCAASGFTFSDAYMDWVRQSPEKGLEWVAEI
RNKANNHATFYAESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCTLQ
YGTSSWGQGTTLTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTW
NSGSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKV
DKKIVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lki A conserved epitope III on hepatitis C virus E2 protein has alternate conformations facilitating cell binding or virus neutralization.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y33 D35 E50 Q101 G103 T104
Binding residue
(residue number reindexed from 1)		Y32 D34 E49 Q100 G102 T103
External links