Structure of PDB 7bbp Chain DDD Binding Site BS01

Receptor Information
>7bbp Chain DDD (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFAT
VRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFE
EHISSVLSDYKSALRFH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bbp Crystal Structure of the second bromodomain of Pleckstrin homology domain interacting protein (PHIP) in complex with H4K5acK8ac
Resolution1.99 Å
Binding residue
(original residue number in PDB)
F1341 V1345 Y1350 A1394 Y1395 T1396 I1403
Binding residue
(residue number reindexed from 1)
F26 V30 Y35 A79 Y80 T81 I88
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7bbp, PDBe:7bbp, PDBj:7bbp
PDBsum7bbp
PubMed
UniProtQ8WWQ0|PHIP_HUMAN PH-interacting protein (Gene Name=PHIP)

[Back to BioLiP]