Structure of PDB 4v5g Chain DC Binding Site BS01

Receptor Information
>4v5g Chain DC (length=228) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKHGKRYRALLEKVDPNKVYTIDEAARLVKELATAKFDETVEVHAKLGID
PRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEII
QKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIG
EIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHK
PEGAKGTFLRSVYVTTTMGPSVRINPHS
Ligand information
>4v5g Chain CW (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucagucgguagagcaggggauugaaaauccccguguccu
ugguucgauuccgaguccgggcacca
<<<<<<<..<<<<........>>>>.<<<<<<.....>>>>>>.....<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v5g The crystal structure of the ribosome bound to EF-Tu and aminoacyl-tRNA.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		R53 S54 G132 P133 R164
Binding residue
(residue number reindexed from 1)		R53 S54 G132 P133 R164
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5g, PDBe:4v5g, PDBj:4v5g
PDBsum4v5g
PubMed19833920
UniProtQ5SLP7|RL1_THET8 Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]