Structure of PDB 4v8p Chain DA Binding Site BS01

Receptor Information
>4v8p Chain DA (length=91) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRGTPAFGKRHQKTHTLCRRCGKATYHKQKLRCAACGYPDAKMRRYDGWG
QKVRDRKGQGTGRMRYMKTIARRAKNGFRSGTQAAPKVKAA
Ligand information
>4v8p Chain C2 (length=154) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaaaauuuucaacgguggauaucuagguucccgugacgaugaagaacgc
agcgaaaugcgauacgcaaugcgaauugcagaaccgcgagucaucagauc
uuugaacgcaagugguggagguguaaaaaccuucauguuuguuucagugu
ggaa
............................................<<<<<<
.<<.....>>>.....(.<<<......>>............>>>..)...
>>>....<<.....>><<<<<<......>>>>>>................
....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
Resolution3.52 Å
Binding residue
(original residue number in PDB)
T17 R20 R21 G23 K29 Y39 Q60 G61 T62 G63 R64 M65 R66 Y67 M68 K69 I71 R73 R74 A75 K76 N77 R80 T83 Q84 A85 P87 K88
Binding residue
(residue number reindexed from 1)
T16 R19 R20 G22 K28 Y38 Q59 G60 T61 G62 R63 M64 R65 Y66 M67 K68 I70 R72 R73 A74 K75 N76 R79 T82 Q83 A84 P86 K87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum4v8p
PubMed22052974
UniProtP0DJ24|RL37_TETTS Large ribosomal subunit protein eL37 (Gene Name=RPL37)

[Back to BioLiP]