Structure of PDB 6i7v Chain D7 Binding Site BS01

Receptor Information
>6i7v Chain D7 (length=68) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPYVTIDVS
SKSHPFYTGKLRTVASEG
Ligand information
>6i7v Chain DB (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugccuggcggccguagcgcgguggucccaccugaccccaugccgaacuca
gaagugaaacgccguagcgccgaugguaguguggggucuccccaugcgag
aguagggaacugccaggca
<<<<<<<<<<.....<<<<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>>.>>.<<.......<<<<<<<<...>>>>>>>>...
....>>...>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6i7v Bacterial ribosome heterogeneity: Changes in ribosomal protein composition during transition into stationary growth phase.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		M1 K2 H6
Binding residue
(residue number reindexed from 1)		M1 K2 H6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6i7v, PDBe:6i7v, PDBj:6i7v
PDBsum6i7v
PubMed30359641
UniProtP0A7N1|RL31B_ECOLI Large ribosomal subunit protein bL31B (Gene Name=ykgM)

[Back to BioLiP]