Structure of PDB 4v9j Chain D1 Binding Site BS01

Receptor Information
>4v9j Chain D1 (length=93) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVR
VAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELL
Ligand information
>4v9j Chain CW (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcuacguagcucaguugguuagagcacaucacucauaaugaugggguca
cagguucgaaucccgucguagccacca
.<<<<<<..<<<...........>>>.<<<<<.......>>>>>.....<
<.<<.......>>.>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v9j Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
Resolution3.86 Å
Binding residue
(original residue number in PDB)		V30 K32 K33
Binding residue
(residue number reindexed from 1)		V28 K30 K31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9j, PDBe:4v9j, PDBj:4v9j
PDBsum4v9j
PubMed23812722
UniProtQ72G84|RL28_THET2 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]