Structure of PDB 9c9m Chain D Binding Site BS01

Receptor Information
>9c9m Chain D (length=47) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKII
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9c9m HIV-1 Intasomes Assembled with Excess Integrase C-Terminal Domain Protein Facilitate Structural Studies by Cryo-EM and Reveal the Role of the Integrase C-terminal Tail in HIV-1 Integration
Resolution2.01 Å
Binding residue
(original residue number in PDB)		W243 E246 G247 A248 R263
Binding residue
(residue number reindexed from 1)		W22 E25 G26 A27 R42
External links
PDB RCSB:9c9m, PDBe:9c9m, PDBj:9c9m
PDBsum9c9m
PubMed39066328
UniProtP12497|POL_HV1N5 Gag-Pol polyprotein (Gene Name=gag-pol)

[Back to BioLiP]