Structure of PDB 9asi Chain D Binding Site BS01

Receptor Information
>9asi Chain D (length=138) Species: 1360 (Lactococcus lactis subsp. lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TELKIGNEKVNSTNFGDFAEKAIRGINHKPFVNSKGGEQKITTSKIRGIL
ELVNKVYNRVINTNDVELSENILADIAYIKVKIAYESGREPVVKDFIQRT
AFTAAITDVMNQRTRESFLLFARYVESLIAYFKFYGGK
Ligand information
>9asi Chain T (length=29) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuucuucagguuggacagcuggugcugcc
.............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9asi Molecular basis for cA6 synthesis by a type III-A CRISPR-Cas enzyme and its conversion to cA4 production.
Resolution2.79 Å
Binding residue
(original residue number in PDB)		T53 T54 S55 K56 R58 Y96 R100 K149
Binding residue
(residue number reindexed from 1)		T42 T43 S44 K45 R47 Y85 R89 K138
External links