Structure of PDB 8z4j Chain D Binding Site BS01

Receptor Information
>8z4j Chain D (length=199) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPF
KGALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASV
DFLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITIS
NPQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATDRFLK
Ligand information
>8z4j Chain M (length=38) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugc
......................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z4j Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution2.97 Å
Binding residue
(original residue number in PDB)
G21 K28 F37 R40 P50 K52 G53 R56 P80 G91 S92 M93 A96 T118 H119 L120 R121 I122 R124 F133 G175
Binding residue
(residue number reindexed from 1)
G20 K27 F36 R39 P49 K51 G52 R55 P79 G90 S91 M92 A95 T117 H118 L119 R120 I121 R123 F132 G174
External links