Structure of PDB 8yhd Chain D Binding Site BS01

Receptor Information
>8yhd Chain D (length=199) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPF
KGALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASV
DFLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITIS
NPQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATDRFLK
Ligand information
>8yhd Chain M (length=53) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugcgcuucgcguuua
agu
..................................................
...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yhd Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		G21 F37 K52 G53 R56 S57 P80 F90 G91 S92 M93 A96 T118 L120 R121 I122 R124 K127 A129 F133 G175 W176
Binding residue
(residue number reindexed from 1)		G20 F36 K51 G52 R55 S56 P79 F89 G90 S91 M92 A95 T117 L119 R120 I121 R123 K126 A128 F132 G174 W175
External links