Structure of PDB 8wq5 Chain D Binding Site BS01

Receptor Information
>8wq5 Chain D (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQIQTDVVLPSCKKKAPAETPVKERLFIVFNPHPLPLDVLEDIFCRFGNL
IEVYLVSGKNVGYAKYADRISANDAIATLHGKILNGVRLKVMLADSPRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wq5 Structural basis for RNA recognition by the C-terminal RRM domain of human RBM45.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		R393 F395 V397 E420 Y422 S425 V429 Y431 K458 A462 D463
Binding residue
(residue number reindexed from 1)		R25 F27 V29 E52 Y54 S57 V61 Y63 K90 A94 D95
External links
PDB RCSB:8wq5, PDBe:8wq5, PDBj:8wq5
PDBsum8wq5
PubMed39122006
UniProtQ8IUH3|RBM45_HUMAN RNA-binding protein 45 (Gene Name=RBM45)

[Back to BioLiP]