Structure of PDB 8vcy Chain D Binding Site BS01

Receptor Information
>8vcy Chain D (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKTTQPPSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGL
KNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVSHNAGNMLTFG
GGTRLMVKPHIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSD
VYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vcy A structural basis of T cell cross-reactivity to a native and spliced self-antigens presented by HLA-DQ8
Resolution2.6 Å
Binding residue
(original residue number in PDB)		S29 N36 H108
Binding residue
(residue number reindexed from 1)		S27 N29 H91
External links