Structure of PDB 8uzt Chain D Binding Site BS01

Receptor Information
>8uzt Chain D (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSLVLERSLNRVHLLGRVGQDPVLRNPVTIFSLATNEMWRDVSQKTTWHR
ISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADN
IIFLSDQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8uzt Structures of the mitochondrial single-stranded DNA binding protein with DNA and DNA polymerase gamma.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
R28 N124
Binding residue
(residue number reindexed from 1)
R7 N88
External links
PDB RCSB:8uzt, PDBe:8uzt, PDBj:8uzt
PDBsum8uzt
PubMed39106165
UniProtQ04837|SSBP_HUMAN Single-stranded DNA-binding protein, mitochondrial (Gene Name=SSBP1)

[Back to BioLiP]