Structure of PDB 8tw9 Chain D Binding Site BS01

Receptor Information
>8tw9 Chain D (length=132) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSVDIDASQWQKLTQSREKQTTVITPLGMMMLEIQGELELPKDFASLARR
DSPNEGRFSEQDGETLIRFGSLQIDGERATLFVGKKQRLLGKVTKLDVPM
GIMHFNSKDNKVELVDVMKYKVIFKDRPLPIM
Ligand information
>8tw9 Chain C (length=26) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TVKIWVKYNEGFSNAVRKNVTWNNLW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tw9 Cryo-EM reveals that Ctf18-RFC collaborates with PolE to load the PCNA clamp onto a leading strand DNA
Resolution3.6 Å
Binding residue
(original residue number in PDB)		P2 Q36 G37 E38 L39 E40 F59 K86 F106 S108
Binding residue
(residue number reindexed from 1)		P1 Q35 G36 E37 L38 E39 F58 K85 F105 S107
External links
PDB RCSB:8tw9, PDBe:8tw9, PDBj:8tw9
PDBsum8tw9
PubMed
UniProtP38877|CTF8_YEAST Chromosome transmission fidelity protein 8 (Gene Name=CTF8)

[Back to BioLiP]