Structure of PDB 8t51 Chain D Binding Site BS01

Receptor Information
>8t51 Chain D (length=217) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVVMTQSPLSLPVTPGEPASISCRSSRSLLTSKGITSLYWYLQKPGQSPQ
LLIYRMSNLASGIPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQFLVYP
YTFGPGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t51 Rapid affinity optimization of an anti-TREM2 clinical lead antibody by cross-lineage immune repertoire mining
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R27 T31 S37 Y39 R55 F96 L97 Y101
Binding residue
(residue number reindexed from 1)		R27 T31 S37 Y39 R55 F96 L97 Y101
External links