Structure of PDB 8srp Chain D Binding Site BS01

Receptor Information
>8srp Chain D (length=86) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NMDYFKYHNMRPPFTYATLIRWAILEAPERQRTLNEIYHWFTRMFAYFRN
HPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDEFE
Ligand information
>8srp Chain N (length=54) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacaaacaaacaaacaaacaaacaaacaaacaaacaaacaaacaaacaa
acaa
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8srp FoxP3 forms Ladder-like multimer to bridge TTTG repeats
Resolution3.7 Å
Binding residue
(original residue number in PDB)		R337 T341 Y342
Binding residue
(residue number reindexed from 1)		R11 T15 Y16
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8srp, PDBe:8srp, PDBj:8srp
PDBsum8srp
PubMed38030726
UniProtQ99JB6|FOXP3_MOUSE Forkhead box protein P3 (Gene Name=Foxp3)

[Back to BioLiP]