Structure of PDB 8shi Chain D Binding Site BS01

Receptor Information
>8shi Chain D (length=273) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPW
VEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQWMYGC
DLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAR
EAEQWRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATL
RCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPS
GEEQRYTCHVQHEGLPEPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8shi Complimentary electrostatics dominate T-cell receptor binding to a psoriasis-associated peptide antigen presented by human leukocyte antigen C∗06:02.
Resolution2.90002 Å
Binding residue
(original residue number in PDB)		Y7 D9 E63 K66 Y67 Q70 A73 N77 W97 Y99 T143 K146 W147 E152 Q155 W156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y6 D8 E62 K65 Y66 Q69 A72 N76 W96 Y98 T142 K145 W146 E151 Q154 W155 Y158 W166 Y170
Enzymatic activity
Enzyme Commision number ?
External links