Structure of PDB 8ryp Chain D Binding Site BS01

Receptor Information
>8ryp Chain D (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLL
IQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRQRGSQG
NLIFGKGTKLSVKPNIQNPDPAVYQLRDSKDKSVCLFTDFDSQTNVSQSK
DSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ryp Structure of S8 TCR in complex with HLA-A*03:01 bound to ELFSYLIEK peptide
Resolution1.81 Å
Binding residue
(original residue number in PDB)
Y32 G97 S98
Binding residue
(residue number reindexed from 1)
Y32 G97 S98
External links