Structure of PDB 8ryo Chain D Binding Site BS01

Receptor Information
>8ryo Chain D (length=183) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QEVTQIPAALSVPEGENLVLNCSFTLRWIYNLQWFRQDPGKGLTSLLLIQ
SSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVNNAGNMLTF
GGGTRLMVKPHIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQDSDV
YITDKCVLDMRSMDFKSNSAVAWSNDFACANAF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ryo Structure of S2-198 TCR in complex with HLA-A*03:01 bound to ELFSYLIEK peptide
Resolution2.05 Å
Binding residue
(original residue number in PDB)
W30 Y32
Binding residue
(residue number reindexed from 1)
W28 Y30
External links