Structure of PDB 8ryn Chain D Binding Site BS01

Receptor Information
>8ryn Chain D (length=186) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLI
QSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVNNAGNMLT
FGGGTRLMVKPHIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKD
SDVYITDKCLDMRKSNSAVAWSNKSDFACANAFNNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ryn Structure of S2 TCR in complex with HLA-A*11:01 bound to ELFSYLIEK peptide
Resolution1.97 Å
Binding residue
(original residue number in PDB)
Y32 A96
Binding residue
(residue number reindexed from 1)
Y31 A95
External links