Structure of PDB 8rn4 Chain D Binding Site BS01

Receptor Information
>8rn4 Chain D (length=33) Species: 1601067 (Influenza B virus (B/Memphis/13/2003)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TNYAKWATGDGLTYQKIMKEVAIDDETMCQEEP
Ligand information
>8rn4 Chain E (length=16) Species: 1601067 (Influenza B virus (B/Memphis/13/2003)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GFMITSKTKRLKAQIP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rn4 Structures of influenza A and B replication complexes give insight into avian to human host adaptation and reveal a role of ANP32 as an electrostatic chaperone for the apo-polymerase.
Resolution2.87 Å
Binding residue
(original residue number in PDB)		Y372 Q373 K374 M386 C387 Q388 E389
Binding residue
(residue number reindexed from 1)		Y14 Q15 K16 M28 C29 Q30 E31
External links