Structure of PDB 8rjw Chain D Binding Site BS01

Receptor Information
>8rjw Chain D (length=177) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAQKVCYIEGHRVINLANE
MFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYG
VSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNK
LPRQLPLEVDLTKAKRQDLEPSVEEAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rjw Mechanism of single-stranded DNA annealing by RAD52-RPA complex
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R55 V63 Y65 K144 T148 K152 R153 R156
Binding residue
(residue number reindexed from 1)		R31 V36 Y38 K117 T121 K125 R126 R129
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0000730 DNA recombinase assembly
GO:0006281 DNA repair
GO:0006302 double-strand break repair
GO:0006310 DNA recombination
GO:0006312 mitotic recombination
GO:0010792 DNA double-strand break processing involved in repair via single-strand annealing
GO:0034599 cellular response to oxidative stress
GO:0045002 double-strand break repair via single-strand annealing
GO:2000819 regulation of nucleotide-excision repair
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0032991 protein-containing complex
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rjw, PDBe:8rjw, PDBj:8rjw
PDBsum8rjw
PubMed38658755
UniProtP43351|RAD52_HUMAN DNA repair protein RAD52 homolog (Gene Name=RAD52)

[Back to BioLiP]