Structure of PDB 8r2g Chain D Binding Site BS01

Receptor Information
>8r2g Chain D (length=240) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGK
TQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHD
AVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVD
FSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTPIGGHILAHAS
TTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8r2g Crystal structure of a BRCA2-DMC1 complex
Resolution3.45 Å
Binding residue
(original residue number in PDB)		Q144 P152 G153 G154 V179
Binding residue
(residue number reindexed from 1)		Q62 P70 G71 G72 V97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0003677 DNA binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0007131 reciprocal meiotic recombination
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r2g, PDBe:8r2g, PDBj:8r2g
PDBsum8r2g
PubMed
UniProtQ14565|DMC1_HUMAN Meiotic recombination protein DMC1/LIM15 homolog (Gene Name=DMC1)

[Back to BioLiP]