Structure of PDB 8qtf Chain D Binding Site BS01

Receptor Information
>8qtf Chain D (length=233) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEERNLLSVAYK
NVIGARRASWRIISSIEQKEESRGNDDHVTAIREYRSKIETELSGICDGI
LKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLA
AYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFD
EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qtf Mechanistic insights into the function of 14-3-3 proteins as negative regulators of brassinosteroid signaling.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K72 R76
Binding residue
(residue number reindexed from 1)		K69 R73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0009742 brassinosteroid mediated signaling pathway
Cellular Component
GO:0000325 plant-type vacuole
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005794 Golgi apparatus
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qtf, PDBe:8qtf, PDBj:8qtf
PDBsum8qtf
PubMed38783418
UniProtQ01525|14332_ARATH 14-3-3-like protein GF14 omega (Gene Name=GRF2)

[Back to BioLiP]