Structure of PDB 8px3 Chain D Binding Site BS01

Receptor Information
>8px3 Chain D (length=144) Species: 10407 (Hepatitis B virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8px3 Peptide dimers aggregate Hepatitis B core proteins in live cells
Resolution3.0 Å
Binding residue
(original residue number in PDB)		L76 E77 D78 S81
Binding residue
(residue number reindexed from 1)		L76 E77 D78 S81
Gene Ontology
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
Cellular Component
GO:0005576 extracellular region

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8px3, PDBe:8px3, PDBj:8px3
PDBsum8px3
PubMed
UniProtW6CP35

[Back to BioLiP]