Structure of PDB 8pm5 Chain D Binding Site BS01

Receptor Information
>8pm5 Chain D (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQ
NRRTKWKRQT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pm5 transcription factor BARHL2 bound to DNA sequences
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R233 K234 R236 T237 F239 T278 N282
Binding residue
(residue number reindexed from 1)		R2 K3 R5 T6 F8 T47 N51
External links
PDB RCSB:8pm5, PDBe:8pm5, PDBj:8pm5
PDBsum8pm5
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]