Structure of PDB 8pk1 Chain D Binding Site BS01

Receptor Information
>8pk1 Chain D (length=107) Species: 1268061 (Streptococcus thermophilus DGCC 7710) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YMRMILMFDMPTDTAEERKAYRKFRKFLLSEGFIMHQFSVYSKLLLNHTA
NTAMVGRLKANNPKKGNITILTVTEKQFARMIYLYGDKNTSIANSEERLV
FLGDNYC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pk1 Structural basis for spacer acquisition in a type II-A CRISPR-Cas system
Resolution3.17 Å
Binding residue
(original residue number in PDB)		F12 D13 P15 T16 Y25 R29 F42 S43 Y45
Binding residue
(residue number reindexed from 1)		F8 D9 P11 T12 Y21 R25 F38 S39 Y41
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8pk1, PDBe:8pk1, PDBj:8pk1
PDBsum8pk1
PubMed
UniProtG3ECR3|CAS2_STRTR CRISPR-associated endoribonuclease Cas2 (Gene Name=cas2)

[Back to BioLiP]