Structure of PDB 8pje Chain D Binding Site BS01

Receptor Information

>8pje Chain D (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFA
SFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREP
NVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLP
FLPSTEDVYDCRVEHWGLDEPLLKHWEFD

Ligand information

>8pje Chain F (length=13) Species: 11320 (Influenza A virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PKYVKQNTLKLAT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8pje A targeted single mutation in influenza A virus universal epitope transforms immunogenicity and protective immunity via CD4 + T cell activation.
Resolution	1.7 Å
Binding residue (original residue number in PDB)	Q9 E11 A52 S53 F54 G58 N62 D66 N69 I72 M73
Binding residue (residue number reindexed from 1)	Q7 E9 A50 S51 F52 G56 N60 D64 N67 I70 M71

External links

PDB	RCSB:8pje, PDBe:8pje, PDBj:8pje
PDBsum	8pje
PubMed	38819988
UniProt	P01903\|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]