Structure of PDB 8p7d Chain D Binding Site BS01

Receptor Information
>8p7d Chain D (length=315) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVF
LEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIG
KGSDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGR
DTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYH
IVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRY
GQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFM
PPGLQELIPFVKPAP
Ligand information
>8p7d Chain R (length=83) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcagugguggccgagugguuaaggcgucggacuugaaauccgauucgcuc
ugcgagcguggguucgaaucccacccacugcgc
<<<<<<<..<<<..........>>><<<<<<.......>>>>>><<<<..
.>>>>..<<<<<.......>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8p7d Structural basis of the cooperation between the m3C-RNA-methyltransferase METTL6 with SerRS amino-acyl-synthetase for tRNA recognition
Resolution4.2 Å
Binding residue
(original residue number in PDB)		S191 G306 S307 H308 R313
Binding residue
(residue number reindexed from 1)		S39 G146 S147 H148 R153
Enzymatic activity
Enzyme Commision number 6.1.1.11: serine--tRNA ligase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0004812 aminoacyl-tRNA ligase activity
GO:0004828 serine-tRNA ligase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0019899 enzyme binding
GO:0042803 protein homodimerization activity
GO:0060090 molecular adaptor activity
GO:0098619 selenocysteine-tRNA ligase activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001514 selenocysteine incorporation
GO:0002181 cytoplasmic translation
GO:0006400 tRNA modification
GO:0006412 translation
GO:0006434 seryl-tRNA aminoacylation
GO:0016525 negative regulation of angiogenesis
GO:1904046 negative regulation of vascular endothelial growth factor production
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p7d, PDBe:8p7d, PDBj:8p7d
PDBsum8p7d
PubMed38918637
UniProtP49591|SYSC_HUMAN Serine--tRNA ligase, cytoplasmic (Gene Name=SARS1)

[Back to BioLiP]