Structure of PDB 8ovj Chain D Binding Site BS01

Receptor Information
>8ovj Chain D (length=160) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPMREIVVKKLCINICVGESGDRLTRASKVLEQLCEQTPVLSRARRNEKI
AVHCTVRGKKAEELLEKGLKVKEFELKSYNFADTGSFGFGIDEHIDLGIK
YDPSTGIYGMDFYVVLGRRGERVAHRKRKCSRVGHSHHVTKEEAMKWFEK
VHDGIIFQAK
Ligand information
>8ovj Chain 8 (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaguacgaccacacuugagugaaaacaccauaucccguccgauuugugaa
guuaagcacucacaggcucaguuaguacugaggucagugaugacucggga
acccugagugccguacucc
<<<<<<<......<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<......<<<<<..<<....>>.>>>>>..
...>>>>>>..>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		N9 M11 R12 Q45 T46 T72 R74 G137 R139 R143 S148 G151 H154
Binding residue
(residue number reindexed from 1)		N1 M3 R4 Q37 T38 T55 R57 G120 R122 R126 S131 G134 H137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum8ovj
PubMed38722744
UniProtP48157|RL11_LEIMA Large ribosomal subunit protein uL5 (Gene Name=RPL11)

[Back to BioLiP]