Structure of PDB 8ol1 Chain D Binding Site BS01

Receptor Information
>8ol1 Chain D (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Ligand information
>8ol1 Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tggagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatcctg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ol1 Nuclear degradation of cGAS is essential for immune homeostasis
Resolution3.5 Å
Binding residue
(original residue number in PDB)		K30 S32 R33 G53 I54 S55 S56 T88
Binding residue
(residue number reindexed from 1)		K1 S3 R4 G24 I25 S26 S27 T59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8ol1, PDBe:8ol1, PDBj:8ol1
PDBsum8ol1
PubMed38418882
UniProtQ93079|H2B1H_HUMAN Histone H2B type 1-H (Gene Name=H2BC9)

[Back to BioLiP]