Structure of PDB 8oi6 Chain D Binding Site BS01

Receptor Information
>8oi6 Chain D (length=354) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVQKDSYVGDEA
QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA
PLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDG
VTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREI
VRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCP
EALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPG
IADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oi6 Molecular mechanisms of inorganic-phosphate release from the core and barbed end of actin filaments.
Resolution3.59 Å
Binding residue
(original residue number in PDB)
T194 G197 Y198 S199 Q246
Binding residue
(residue number reindexed from 1)
T186 G189 Y190 S191 Q238
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0019901 protein kinase binding
GO:0098973 structural constituent of postsynaptic actin cytoskeleton
Biological Process
GO:0007409 axonogenesis
GO:0048870 cell motility
GO:0098974 postsynaptic actin cytoskeleton organization
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005884 actin filament
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0015629 actin cytoskeleton
GO:0016020 membrane
GO:0030424 axon
GO:0032991 protein-containing complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0045202 synapse
GO:0097433 dense body

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8oi6, PDBe:8oi6, PDBj:8oi6
PDBsum8oi6
PubMed37749275
UniProtP60712|ACTB_BOVIN Actin, cytoplasmic 1 (Gene Name=ACTB)

[Back to BioLiP]