Structure of PDB 8kd7 Chain D Binding Site BS01

Receptor Information
>8kd7 Chain D (length=188) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HYQGWKSSWLQIPIKLKSVLVDDWEYVTKDKKICRLPADVTVEMVLNKYE
HEVSQELESPGSQSQLSEYCAGLKLYFDKCLGNMLLYRLERLQYDELLKK
SSKDQKPLVPIRIYGAIHLLRLISVLPELISSTTMDLQSCQLLIKQTEDF
LVWLLMHVDEYFNDKDPNRSDDALYVNTSSQYEGVALG
Ligand information
>8kd7 Chain X (length=153) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tctagaacaggatgtatatatctgacacgtgcctggagactagggagtaa
tccccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcg
gtgctagagctgtctacgaccaattgagcggcctcggcaccgggattctc
cag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kd7 Structural basis of nucleosome deacetylation and DNA linker tightening by Rpd3S histone deacetylase complex.
Resolution3.09 Å
Binding residue
(original residue number in PDB)		G83 W84 S87 W88
Binding residue
(residue number reindexed from 1)		G4 W5 S8 W9
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0035064 methylated histone binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006335 DNA replication-dependent chromatin assembly
GO:0006337 nucleosome disassembly
GO:0006338 chromatin remodeling
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:0009889 regulation of biosynthetic process
GO:0030174 regulation of DNA-templated DNA replication initiation
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0043487 regulation of RNA stability
GO:0045892 negative regulation of DNA-templated transcription
GO:0060195 negative regulation of antisense RNA transcription
Cellular Component
GO:0000123 histone acetyltransferase complex
GO:0005634 nucleus
GO:0032221 Rpd3S complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:1990453 nucleosome disassembly/reassembly complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8kd7, PDBe:8kd7, PDBj:8kd7
PDBsum8kd7
PubMed37666978
UniProtQ12432|EAF3_YEAST Chromatin modification-related protein EAF3 (Gene Name=EAF3)

[Back to BioLiP]