Structure of PDB 8k6m Chain D Binding Site BS01

Receptor Information
>8k6m Chain D (length=300) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLS
FSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVL
IAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEP
FQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFK
IYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFN
TVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQF
Ligand information
>8k6m Chain E (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YPSKPDNPGMARYYSALRHYINLITRQRY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k6m Structural complex of neuropeptide Y receptor 1
Resolution3.3 Å
Binding residue
(original residue number in PDB)		C93 T97 Y100 D104 Q120 E182 P183 F199 R208 T212 N283 F286 H306
Binding residue
(residue number reindexed from 1)		C60 T64 Y67 D71 Q87 E149 P150 F166 R175 T179 N250 F253 H273
Gene Ontology
Molecular Function
GO:0001601 peptide YY receptor activity
GO:0001602 pancreatic polypeptide receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004983 neuropeptide Y receptor activity
GO:0005515 protein binding
GO:0008188 neuropeptide receptor activity
GO:0042923 neuropeptide binding
Biological Process
GO:0003151 outflow tract morphogenesis
GO:0006006 glucose metabolic process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007218 neuropeptide signaling pathway
GO:0007626 locomotory behavior
GO:0007631 feeding behavior
GO:0008217 regulation of blood pressure
GO:0019233 sensory perception of pain
GO:0040014 regulation of multicellular organism growth
Cellular Component
GO:0005886 plasma membrane
GO:0043005 neuron projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k6m, PDBe:8k6m, PDBj:8k6m
PDBsum8k6m
PubMed
UniProtP25929|NPY1R_HUMAN Neuropeptide Y receptor type 1 (Gene Name=NPY1R)

[Back to BioLiP]