Structure of PDB 8jv0 Chain D Binding Site BS01

Receptor Information
>8jv0 Chain D (length=275) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLSYFYTAVSRPDRGDSRFFIVGYVDDTQFVRFDSDAPNAKMEPRAQ
WIQQEGQEYWDRETQISKDNAQINRVNLNTLRGYYNQSEAGSHTLQRMYG
CYLGPDGLLLRGYDQDAYDGADYIALNEDLRSWTAADMAAQISKRKREAA
DEAERMRSYLQGRCVEWLQKYLEMGKDTLQRAEPPKTHVTRHPSSDLGVT
LRCWALGFYPKEISLSWQREGQDQSQDMELVETRPSGDGTFQKWAALVVP
PGEEQSYTCHVQHEGLQEPLTLRWD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jv0 Crystal structure of the SLA-2*1001 allele and ASFV antigenic peptide at 2.2A resolution
Resolution2.2 Å
Binding residue
(original residue number in PDB)
Y7 Y9 M45 R62 E63 N77 Y84 L95 R97 Y99 D116 S143 R147 E152 M156 Y159 R163 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 Y9 M45 R62 E63 N77 Y84 L95 R97 Y99 D116 S143 R147 E152 M156 Y159 R163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links