Structure of PDB 8jrk Chain D Binding Site BS01

Receptor Information
>8jrk Chain D (length=178) Species: 29078 (Eptesicus fuscus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PAHFLYQVKFECQFSNGTERVRYLHRSIYNGQEDVRFDSDVGEFRALTEL
GRPRAEYWNSQKDYLEDERASVDTYCRHNYGVLDGFLVHRQTAPTVTVFP
ALLVCSVNGFYPGPIEVRWLRDGREEQAGVVSTGLIRNGDWTFQMLVMLE
TVPRSGEVYTCHVQHPSSSSPVTVEWRA
Ligand information
>8jrk Chain F (length=13) Species: 11137 (Human coronavirus 229E) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NDILSRLDPPEAS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jrk Crystal structure of the bat MHC II molecule at 2.3 A resolution
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Y42 V44 F46 Y59 H61 S63 R90 W94 Y100 E104 S107 Y111 H114 N115
Binding residue
(residue number reindexed from 1)		Y6 V8 F10 Y23 H25 S27 R54 W58 Y64 E68 S71 Y75 H78 N79
External links