Structure of PDB 8j62 Chain D Binding Site BS01

Receptor Information
>8j62 Chain D (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSL
QFFPASWQREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGC
LEFD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j62 Structural insights into RNA bridging between HIV-1 Vif and antiviral factor APOBEC3G.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		F32 R43 R52 S53 E54
Binding residue
(residue number reindexed from 1)		F16 R27 R36 S37 E38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003713 transcription coactivator activity
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8j62, PDBe:8j62, PDBj:8j62
PDBsum8j62
PubMed37419875
UniProtQ13951|PEBB_HUMAN Core-binding factor subunit beta (Gene Name=CBFB)

[Back to BioLiP]