Structure of PDB 8ip0 Chain D Binding Site BS01

Receptor Information
>8ip0 Chain D (length=299) Species: 1147 (Synechocystis sp. PCC 6714) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLNLFATILTYPAPASNYRGESEENRSVIQKILKDGQKYAIISPESMRNA
LREMLIELGQPNNRTRLHSEDQLAVEFKEYPNPDKFADDFLFGYMVAQTN
DAKEMKKLNRPAKRDSIFRCNMAVAVNPYKYDTVFYQSPLNAGDSAWKNS
TSSALLHREVTHTAFQYPFALAGKDCAAKPEWVKALLQAIAELNGVAGGH
ARAYYEFAPRSVVARLTPKLVAGYQTYGFDAEGNWLELSRLTATDSDNLD
LPANEFWLGGELVRKMDQEQKAQLEAMGAHLYANPEKLFADLADSFLGV
Ligand information
>8ip0 Chain F (length=44) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agagcacuuuuaucaccguguccccaaucuggauauuuugugug
............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ip0 Cryo-EM structure of type I-B Cascade bound to a PAM-containing dsDNA target at 3.6 angstrom resolution.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		N19 Y20 R21 E23 E47 S48 N51 R66 R68 Y96 M97 R116 F137 Y138 Q139 S140 G200 G201 R204
Binding residue
(residue number reindexed from 1)		N17 Y18 R19 E21 E45 S46 N49 R64 R66 Y94 M95 R114 F135 Y136 Q137 S138 G198 G199 R202
Enzymatic activity
Enzyme Commision number ?
External links