Structure of PDB 8i60 Chain D Binding Site BS01

Receptor Information
>8i60 Chain D (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPIVYGNVARYFHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRV
VTKPPYEITETGWGEFEIIIKPVTLYHLLKLFQSDTNAMLGKKTVVSEFY
DEMI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i60 Histone H3 lysine 27 crotonylation mediates gene transcriptional repression in chromatin.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		H43 H71 S73 Y74 G92 W93 G94 E95 F96 F121
Binding residue
(residue number reindexed from 1)		H13 H41 S43 Y44 G62 W63 G64 E65 F66 F82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:8i60, PDBe:8i60, PDBj:8i60
PDBsum8i60
PubMed37311463
UniProtO95619|YETS4_HUMAN YEATS domain-containing protein 4 (Gene Name=YEATS4)

[Back to BioLiP]