Structure of PDB 8hxy Chain D Binding Site BS01

Receptor Information
>8hxy Chain D (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEAS
RLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>8hxy Chain I (length=170) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctgccagttctagactggagaatcccggtgccgaggccgctcaattggtc
gtagacagctctagcaccgcttaaacgcacgtacgcgctgtcccccgcgt
tttaaccgccaaggggattactccctagtctccaggcacgtgtcagatat
atacatcctgtgcatgtatt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hxy Structure of histone deacetylase complex Rpd3S bound to nucleosome
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R26 R27 K28 R30 I36 Y37
Binding residue
(residue number reindexed from 1)		R1 R2 K3 R5 I11 Y12
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8hxy, PDBe:8hxy, PDBj:8hxy
PDBsum8hxy
PubMed37798513
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]