Structure of PDB 8hk1 Chain D Binding Site BS01

Receptor Information
>8hk1 Chain D (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VEEDRNTNVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDN
QGNLKGDGLCCYLKRESVELALKLLDEDEIRGYKLHVEVAKFQLDYKKKL
SMQQKQLDWRPER
Ligand information
>8hk1 Chain H (length=148) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccggcuaagaucaaguguaguaucuguucuuaucaguuuaauaucugau
uccucgaggaggauuuuuggagcagggagauggaauaggagcuugcuccg
uccacuccacgcaucgaccugguauugcaguaccuccaggaacggugc
<<..>>...<<.<<.<<<...>>>.>>.>>..<<<<<........>>>>>
<<<<..>>>>...............<<<<.<<<<...<<<<....>>>>.
>>>>>>>>..<<<<<<.<<<<<.............>>>>>..>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hk1 Mechanisms of the RNA helicases DDX42 and DDX46 in human U2 snRNP assembly.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R250 P251 E252
Binding residue
(residue number reindexed from 1)		R110 P111 E112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0140463 chromatin-protein adaptor activity
GO:0160004 poly-ADP-D-ribose modification-dependent protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0000724 double-strand break repair via homologous recombination
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
GO:1990166 protein localization to site of double-strand break
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0005694 chromosome
GO:0035861 site of double-strand break

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hk1, PDBe:8hk1, PDBj:8hk1
PDBsum8hk1
PubMed36797247
UniProtO43719|HTSF1_HUMAN 17S U2 SnRNP complex component HTATSF1 (Gene Name=HTATSF1)

[Back to BioLiP]