Structure of PDB 8gxc Chain D Binding Site BS01

Receptor Information
>8gxc Chain D (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Ligand information
>8gxc Chain B (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggagcguuacguccgaaagucgcauugcacuccgcgacacggcucuuuaa
aaacaaaagga
<<<<<......(((....<<<<<..........>>>>>...>>>>>....
........)))
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gxc Structure-based investigations of the NAD+-II riboswitch.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y12 N14 N15 E18 K21 L43 V44 S45 L48 K49 R51 Q53 F55 Q84 Y85 K87 T88 D89 S90 D91
Binding residue
(residue number reindexed from 1)		Y8 N10 N11 E14 K17 L39 V40 S41 L44 K45 R47 Q49 F51 Q80 Y81 K83 T84 D85 S86 D87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:8gxc, PDBe:8gxc, PDBj:8gxc
PDBsum8gxc
PubMed36610789
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]