Structure of PDB 8gxb Chain D Binding Site BS01

Receptor Information
>8gxb Chain D (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAF
VIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Ligand information
>8gxb Chain B (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggagcguuacguccgaaagucgcauugcacuccgcgacacggcucuuuaa
aaacaaaagga
<<<<<......(((....<<<<<..........>>>>>...>>>>>....
........)))
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gxb Structure-based investigations of the NAD+-II riboswitch.
Resolution2.15 Å
Binding residue
(original residue number in PDB)
Y12 N14 N15 E18 K21 S47 L48 K49 M50 R51 Q53 F55 K79 Q84 K87 D89 S90 D91
Binding residue
(residue number reindexed from 1)
Y7 N9 N10 E13 K16 S42 L43 K44 M45 R46 Q48 F50 K74 Q79 K82 D84 S85 D86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:8gxb, PDBe:8gxb, PDBj:8gxb
PDBsum8gxb
PubMed36610789
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]