Structure of PDB 8gon Chain D Binding Site BS01

Receptor Information
>8gon Chain D (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AQTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIR
QEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCASSGNTPL
VFGKGTRLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSK
DSDVYITDKCVLDMRSMDFKSNSAVAWSNKFACANAFNNS
Ligand information
>8gon Chain C (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RLQSLQIYV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gon Structural insights into protection against a SARS-CoV-2 spike variant by T cell receptor (TCR) diversity.
Resolution2.601 Å
Binding residue
(original residue number in PDB)		S28 D31 G96 N97
Binding residue
(residue number reindexed from 1)		S28 D31 G96 N97
External links