Structure of PDB 8gbj Chain D Binding Site BS01

Receptor Information
>8gbj Chain D (length=308) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALV
ALRRVLLAQFSAFPVNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGE
VTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLLQ
AKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVSGTVKVVV
VDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITRD
RDSGRLKPALGRSWSFVPSTRILLDTIEGSGGRRMACLAKSSRQPTGFQE
MVDIGTWG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gbj Structural insights into BCDX2 complex function in homologous recombination.
Resolution3.11 Å
Binding residue
(original residue number in PDB)		L216 G217 R221 I251 T252 R253 R255 L264 G265 R266
Binding residue
(residue number reindexed from 1)		L212 G213 R217 I247 T248 R249 R251 L260 G261 R262
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000400 four-way junction DNA binding
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0043015 gamma-tubulin binding
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0000722 telomere maintenance via recombination
GO:0000723 telomere maintenance
GO:0000724 double-strand break repair via homologous recombination
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0006974 DNA damage response
GO:0007131 reciprocal meiotic recombination
GO:0036297 interstrand cross-link repair
GO:0042148 DNA strand invasion
GO:0051276 chromosome organization
GO:0051726 regulation of cell cycle
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005657 replication fork
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005856 cytoskeleton
GO:0033063 Rad51B-Rad51C-Rad51D-XRCC2 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8gbj, PDBe:8gbj, PDBj:8gbj
PDBsum8gbj
PubMed37344589
UniProtO75771|RA51D_HUMAN DNA repair protein RAD51 homolog 4 (Gene Name=RAD51D)

[Back to BioLiP]