Structure of PDB 8fbw Chain D Binding Site BS01

Receptor Information
>8fbw Chain D (length=216) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSVLTQPPSASGAPGQSVTISCSGSSSNIGSNYVYWYQQLSGKAPKLLIY
NNNQRPSGVPDRFSGSKSGTSASLAISGLQSKDEADYYCSAWDSSLNDPL
FGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVEV
AWKADGSAVNAGVETTKPSKQSNNKYAASSYLSLTSDQWKSHKSYSCQVT
HEGSTVEKTVAPAECS
Ligand information
>8fbw Chain E (length=16) Species: 11723 (Simian immunodeficiency virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LKSDKKIEYNETWYSR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fbw Effect of Passive Administration of Monoclonal Antibodies Recognizing Simian Immunodeficiency Virus (SIV) V2 in CH59-Like Coil/Helical or beta-Sheet Conformations on Time of SIV mac251 Acquisition.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		W92 N97 D98
Binding residue
(residue number reindexed from 1)		W92 N97 D98
External links