Structure of PDB 8e2p Chain D Binding Site BS01

Receptor Information
>8e2p Chain D (length=151) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNRAIGLHDPT
AHAEIMALRQGGLVMQNYRLYDATLYSTFEPCVMCAGAMIHSRIGRVVFG
VRNAKTGAAGSLMDVLHHPGMNHRVEITEGILADECAALLCRFFRMPRRV
F
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e2p Improved cytosine base editors generated from TadA variants.
Resolution2.72 Å
Binding residue
(original residue number in PDB)		Y73 R74 Y76 R98
Binding residue
(residue number reindexed from 1)		Y68 R69 Y71 R93
Enzymatic activity
Enzyme Commision number 3.5.4.33: tRNA(adenine(34)) deaminase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0008251 tRNA-specific adenosine deaminase activity
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0052717 tRNA-specific adenosine-34 deaminase activity
Biological Process
GO:0002100 tRNA wobble adenosine to inosine editing
GO:0006382 adenosine to inosine editing
GO:0008033 tRNA processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8e2p, PDBe:8e2p, PDBj:8e2p
PDBsum8e2p
PubMed36624149
UniProtP68398|TADA_ECOLI tRNA-specific adenosine deaminase (Gene Name=tadA)

[Back to BioLiP]