Structure of PDB 8czg Chain D Binding Site BS01

Receptor Information
>8czg Chain D (length=160) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSEEQVAQDTEEVFRSYVFYRHQQEQEAEPADPEMVTLPLQPSSTMGQVG
RQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINW
GRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQRG
GWVAALNLGN
Ligand information
>8czg Chain H (length=21) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SLLEKLAEELRQLADELNKKF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8czg Peptides from human BNIP5 and PXT1 and non-native binders of pro-apoptotic BAK can directly activate or inhibit BAK-mediated membrane permeabilization.
Resolution1.99 Å
Binding residue
(original residue number in PDB)		I81 R88 Y89 F93 M96 H99 L100 I114 S117 N124 W125 G126 R127 V129
Binding residue
(residue number reindexed from 1)		I56 R63 Y64 F68 M71 H74 L75 I89 S92 N99 W100 G101 R102 V104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:8czg, PDBe:8czg, PDBj:8czg
PDBsum8czg
PubMed36706751
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]