Structure of PDB 8csh Chain D Binding Site BS01

Receptor Information
>8csh Chain D (length=53) Species: 45202 (unidentified plasmid) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKTIKMVADELNVTKQTVVNNAKNLNISFEKENGVNYIDDNDYLKIVEKI
TKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8csh Molecular Analysis of pSK1 par: A Novel Plasmid Partitioning System Encoded by Staphylococcal Multiresistance Plasmids.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		K5 K15 Q16 K31 G34 N36
Binding residue
(residue number reindexed from 1)		K5 K15 Q16 K31 G34 N36
Enzymatic activity
Enzyme Commision number ?
External links