Structure of PDB 8com Chain D Binding Site BS01

Receptor Information
>8com Chain D (length=93) Species: 185431 (Trypanosoma brucei brucei TREU927) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RQRKRTWNVYVSRSLRSINSQMSMTSRTMKIVNSFVNDLFERIAAEAATI
VRVNRKRTLGARELQTAVRLVLPADLAKHAMAEGTKAVSHASS
Ligand information
>8com Chain I (length=127) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tctgacacgtgcctggagactagggagtaatccccttggcggttaaaacg
cgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacgac
caattgagcggcctcggcaccgggatt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8com Histone divergence in trypanosomes results in unique alterations to nucleosome structure.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Q20 R34 T43 S44 R75 T76
Binding residue
(residue number reindexed from 1)		Q2 R16 T25 S26 R57 T58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0042301 phosphate ion binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
GO:0051276 chromosome organization
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8com, PDBe:8com, PDBj:8com
PDBsum8com
PubMed37427792
UniProtQ389T1

[Back to BioLiP]